Recombinant Full Length Methanocaldococcus Jannaschii Hyperpolarization-Activated Voltage-Gated Potassium Channel(Mvp) Protein, His-Tagged
Cat.No. : | RFL31092MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Hyperpolarization-activated voltage-gated potassium channel(mvp) Protein (Q57603) (1-209aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-209) |
Form : | Lyophilized powder |
AA Sequence : | MNLKDRRLKKIMEVLSLIFTFEIVASFILSTYNPPYQDLLIKLDYISIMFFTFEFIYNFY YVEDKAKFFKDIYNIVDAIVVIAFLLYSLQVFYSKAFLGLRVINLLRILVLLRIIKLRKL EENQALINFLTLLTICFIASCLIWIVESGVNPAINNFFDAFYFTTISITTVGYGDITPKT DAGKLIIIFSVLFFISGLITSLQKALKGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mvp |
Synonyms | mvp; MJ0139; Hyperpolarization-activated voltage-gated potassium channel; MVP |
UniProt ID | Q57603 |
◆ Recombinant Proteins | ||
MVP-1131HFL | Recombinant Full Length Human MVP, Flag-tagged | +Inquiry |
MVP-1081HFL | Recombinant Full Length Human MVP Protein, C-Flag-tagged | +Inquiry |
MVP-6998HF | Recombinant Full Length Human MVP Protein, GST-tagged | +Inquiry |
MVP-5381H | Recombinant Human MVP Protein (Ala2-Pro272), N-His tagged | +Inquiry |
MVP-1117H | Recombinant Human MVP, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MVP-4050HCL | Recombinant Human MVP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mvp Products
Required fields are marked with *
My Review for All mvp Products
Required fields are marked with *