Recombinant Full Length Mouse 3-Ketodihydrosphingosine Reductase(Kdsr) Protein, His-Tagged
Cat.No. : | RFL17653MF |
Product Overview : | Recombinant Full Length Mouse 3-ketodihydrosphingosine reductase(Kdsr) Protein (Q6GV12) (26-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (26-332) |
Form : | Lyophilized powder |
AA Sequence : | KPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKDIEKHSINDKQ VVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEELEVSSFEKLMSIN YLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSSSKFAIRGLAEALQMEVK PYNVYVTVAYPPDTDTPGLAEENKTKPLETRLISETTAICKPEQVAKQIVKDAIQGNFNS SIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNIVRRCMVQKAKP EVVDKTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kdsr |
Synonyms | Kdsr; Fvt1; 3-ketodihydrosphingosine reductase; KDS reductase; 3-dehydrosphinganine reductase; Follicular variant translocation protein 1 homolog; FVT-1 |
UniProt ID | Q6GV12 |
◆ Recombinant Proteins | ||
KDSR-1045HFL | Recombinant Full Length Human KDSR Protein, C-Flag-tagged | +Inquiry |
Kdsr-3685M | Recombinant Mouse Kdsr Protein, Myc/DDK-tagged | +Inquiry |
KDSR-5239HF | Recombinant Full Length Human KDSR Protein, GST-tagged | +Inquiry |
KDSR-26267TH | Recombinant Human KDSR, His-tagged | +Inquiry |
KDSR-2384R | Recombinant Rhesus monkey KDSR Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDSR-356HCL | Recombinant Human KDSR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kdsr Products
Required fields are marked with *
My Review for All Kdsr Products
Required fields are marked with *