Recombinant Full Length Mouse 4-Hydroxybenzoate Polyprenyltransferase, Mitochondrial(Coq2) Protein, His-Tagged
Cat.No. : | RFL5960MF |
Product Overview : | Recombinant Full Length Mouse 4-hydroxybenzoate polyprenyltransferase, mitochondrial(Coq2) Protein (Q66JT7) (35-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (35-374) |
Form : | Lyophilized powder |
AA Sequence : | AGVPGARDRRAPAPGTQRGRALSLSAAAVVNSAPRPLQPYLRLMRLDKPIGTWLLYLPCT WSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVTRTANRPIAAGDI STFQSFVFLGGQLTLALGVLLCLNYYSIAMGAASLLLVVTYPLVKRITFWPQLALGLTFN WGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTALLFQEN TRQWLSGFGVAMVAALSLAGANNGQTVPYYAAVAAVGAHLAHQIYTVDIHRAEDCWDKFT SNRTVGMLLFLGIVLGNLCKEKTEEAKDAEAVRVGSEQTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Coq2 |
Synonyms | Coq2; 4-hydroxybenzoate polyprenyltransferase, mitochondrial; 4-HB polyprenyltransferase; Para-hydroxybenzoate--polyprenyltransferase; PHB:PPT; PHB:polyprenyltransferase |
UniProt ID | Q66JT7 |
◆ Recombinant Proteins | ||
COQ2-3790M | Recombinant Mouse COQ2 Protein | +Inquiry |
COQ2-1897M | Recombinant Mouse COQ2 Protein, His (Fc)-Avi-tagged | +Inquiry |
COQ2-1194R | Recombinant Rat COQ2 Protein, His (Fc)-Avi-tagged | +Inquiry |
COQ2-1973HF | Recombinant Full Length Human COQ2 Protein, GST-tagged | +Inquiry |
COQ2-5589Z | Recombinant Zebrafish COQ2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Coq2 Products
Required fields are marked with *
My Review for All Coq2 Products
Required fields are marked with *
0
Inquiry Basket