Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 5A(Htr5A) Protein, His-Tagged
Cat.No. : | RFL28430MF |
Product Overview : | Recombinant Full Length Mouse 5-hydroxytryptamine receptor 5A(Htr5a) Protein (P30966) (1-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-357) |
Form : | Lyophilized powder |
AA Sequence : | MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLTLLGFLAAATFTWNLL VLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMILLTWALSTVISLAPLLFG WGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYRAAKFRMGSRKTNSVS PVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP FFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Htr5a |
Synonyms | Htr5a; 5ht5a; 5-hydroxytryptamine receptor 5A; 5-HT-5; 5-HT-5A; 5-HT5A; Serotonin receptor 5A |
UniProt ID | P30966 |
◆ Recombinant Proteins | ||
RFL28430MF | Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 5A(Htr5A) Protein, His-Tagged | +Inquiry |
HTR5A-301334H | Recombinant Human HTR5A protein, GST-tagged | +Inquiry |
HTR5A-242HF | Recombinant Full Length Human HTR5A Protein | +Inquiry |
HTR5A-2968R | Recombinant Rat HTR5A Protein | +Inquiry |
HTR5A-2295H | Recombinant Human HTR5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Htr5a Products
Required fields are marked with *
My Review for All Htr5a Products
Required fields are marked with *
0
Inquiry Basket