Recombinant Full Length Mouse Adenosine Receptor A3(Adora3) Protein, His-Tagged
Cat.No. : | RFL32181MF |
Product Overview : | Recombinant Full Length Mouse Adenosine receptor A3(Adora3) Protein (Q61618) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MEADNTTETDWLNITYITMEAAIGLCAVVGNMLVIWVVKLNPTLRTTTVYFIVSLALADI AVGVLVIPLAIAVSLQVKMHFYACLFMSCVLLIFTHASIMSLLAIAVHRYLRVKLTVRYR TVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKATLASSQNSSTLLCHFRSVVSLDYMVF FSFITWILVPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFLF ALCWLPLSIINFVSYFDVKIPDVAMCLGILLSHANSMMNPIVYACKIKKFKETYFLILRA VRLCQTSDSLDSNMEQTTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Adora3 |
Synonyms | Adora3; Gpcr2; Adenosine receptor A3; A3AR |
UniProt ID | Q61618 |
◆ Recombinant Proteins | ||
ADORA3-191R | Recombinant Rat ADORA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADORA3-26898TH | Recombinant Human ADORA3 | +Inquiry |
RFL32181MF | Recombinant Full Length Mouse Adenosine Receptor A3(Adora3) Protein, His-Tagged | +Inquiry |
ADORA3-968HF | Recombinant Full Length Human ADORA3 Protein | +Inquiry |
RFL-17161OF | Recombinant Full Length Sheep Adenosine Receptor A3(Adora3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADORA3-12HCL | Recombinant Human ADORA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Adora3 Products
Required fields are marked with *
My Review for All Adora3 Products
Required fields are marked with *
0
Inquiry Basket