Recombinant Full Length Mouse Adp/Atp Translocase 1(Slc25A4) Protein, His-Tagged
| Cat.No. : | RFL5287MF |
| Product Overview : | Recombinant Full Length Mouse ADP/ATP translocase 1(Slc25a4) Protein (P48962) (2-298aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-298) |
| Form : | Lyophilized powder |
| AA Sequence : | GDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSV QGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQ SGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Slc25a4 |
| Synonyms | Slc25a4; Aac1; Anc1; Ant1; ADP/ATP translocase 1; ADP,ATP carrier protein 1; ADP,ATP carrier protein, heart/skeletal muscle isoform T1; Adenine nucleotide translocator 1; ANT 1; Solute carrier family 25 member 4 |
| UniProt ID | P48962 |
| ◆ Recombinant Proteins | ||
| RFL5287MF | Recombinant Full Length Mouse Adp/Atp Translocase 1(Slc25A4) Protein, His-Tagged | +Inquiry |
| RFL17241BF | Recombinant Full Length Bovine Adp/Atp Translocase 1(Slc25A4) Protein, His-Tagged | +Inquiry |
| SLC25A4-15327M | Recombinant Mouse SLC25A4 Protein | +Inquiry |
| SLC25A4-3220B | Recombinant Bovine SLC25A4, His-tagged | +Inquiry |
| SLC25A4-8290M | Recombinant Mouse SLC25A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC25A4-1762HCL | Recombinant Human SLC25A4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc25a4 Products
Required fields are marked with *
My Review for All Slc25a4 Products
Required fields are marked with *
