Recombinant Full Length Mouse Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G3) Protein, His-Tagged
| Cat.No. : | RFL1706MF |
| Product Overview : | Recombinant Full Length Mouse ATP synthase lipid-binding protein, mitochondrial(Atp5g3) Protein (P56384) (67-141aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (67-141) |
| Form : | Lyophilized powder |
| AA Sequence : | DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Atp5g3 |
| Synonyms | Atp5mc3; Atp5g3; ATP synthase F(0 complex subunit C3, mitochondrial; ATP synthase lipid-binding protein; ATP synthase membrane subunit c locus 3; ATP synthase proteolipid P3; ATPase protein 9; ATPase subunit c |
| UniProt ID | P56384 |
| ◆ Recombinant Proteins | ||
| RFL1706MF | Recombinant Full Length Mouse Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G3) Protein, His-Tagged | +Inquiry |
| ATP5G3-5204C | Recombinant Chicken ATP5G3 | +Inquiry |
| ATP5G3-530R | Recombinant Rat ATP5G3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP5G3-3702H | Recombinant Human ATP5G3, GST-tagged | +Inquiry |
| ATP5G3-983H | Recombinant Human ATP5G3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Atp5g3 Products
Required fields are marked with *
My Review for All Atp5g3 Products
Required fields are marked with *



