Recombinant Full Length Mouse Bcl-2-Like Protein 1(Bcl2L1) Protein, His-Tagged
| Cat.No. : | RFL13751MF |
| Product Overview : | Recombinant Full Length Mouse Bcl-2-like protein 1(Bcl2l1) Protein (Q64373) (1-233aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-233) |
| Form : | Lyophilized powder |
| AA Sequence : | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Bcl2l1 |
| Synonyms | Bcl2l1; Bcl2l; Bclx; Bcl-2-like protein 1; Bcl2-L-1; Apoptosis regulator Bcl-X |
| UniProt ID | Q64373 |
| ◆ Recombinant Proteins | ||
| RFL18302RF | Recombinant Full Length Rat Bcl-2-Like Protein 1(Bcl2L1) Protein, His-Tagged | +Inquiry |
| BCL2L1-0383H | Recombinant Human BCL2L1 Protein (Met1-Lys233), N-His-tagged | +Inquiry |
| Bcl2l1-1242R | Recombinant Rat Bcl2l1 protein, His-tagged | +Inquiry |
| BCL2L1-511H | Recombinant Human BCL2L1 protein, His-tagged | +Inquiry |
| BCL2L1-9318Z | Recombinant Zebrafish BCL2L1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCL2L1-8488HCL | Recombinant Human BCL2L1 293 Cell Lysate | +Inquiry |
| BCL2L1-8489HCL | Recombinant Human BCL2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bcl2l1 Products
Required fields are marked with *
My Review for All Bcl2l1 Products
Required fields are marked with *
