Recombinant Full Length Mouse Bet1-Like Protein(Bet1L) Protein, His-Tagged
Cat.No. : | RFL27820MF |
Product Overview : | Recombinant Full Length Mouse BET1-like protein(Bet1l) Protein (O35153) (1-111aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-111) |
Form : | Lyophilized powder |
AA Sequence : | MADWTRAQSSGAVEDILDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTMARSGRDNRKLLCGMAVVLIVAFFILSYLLSRTRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bet1l |
Synonyms | Bet1l; Gs15; BET1-like protein; Golgi SNARE with a size of 15 kDa; GOS-15; GS15; Vesicle transport protein GOS15 |
UniProt ID | O35153 |
◆ Recombinant Proteins | ||
BET1L-2841C | Recombinant Chicken BET1L | +Inquiry |
BET1L-179H | Recombinant Human BET1L Protein, HIS-tagged | +Inquiry |
RFL27820MF | Recombinant Full Length Mouse Bet1-Like Protein(Bet1L) Protein, His-Tagged | +Inquiry |
BET1L-628R | Recombinant Rat BET1L Protein, His (Fc)-Avi-tagged | +Inquiry |
BET1L-1016M | Recombinant Mouse BET1L Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bet1l Products
Required fields are marked with *
My Review for All Bet1l Products
Required fields are marked with *