Recombinant Full Length Mouse C-C Chemokine Receptor Type 2(Ccr2) Protein, His-Tagged
Cat.No. : | RFL4539MF |
Product Overview : | Recombinant Full Length Mouse C-C chemokine receptor type 2(Ccr2) Protein (P51683) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-373) |
Form : | Lyophilized powder |
AA Sequence : | MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPP LYSLVFIFGFVGNMLVIIILIGCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAANEWV FGNIMCKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVV AVFASLPGIIFTKSKQDDHHYTCGPYFTQLWKNFQTIMRNILSLILPLLVMVICYSGILH TLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTTFQESLGMSNCVIDKHLDQAM QVTETLGMTHCCINPVIYAFVGEKFRRYLSIFFRKHIAKRLCKQCPVFYRETADRVSSTF TPSTGEQEVSVGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ccr2 |
Synonyms | Ccr2; Cmkbr2; C-C chemokine receptor type 2; C-C CKR-2; CC-CKR-2; CCR-2; CCR2; JE/FIC receptor; MCP-1 receptor; CD antigen CD192 |
UniProt ID | P51683 |
◆ Recombinant Proteins | ||
CCR2-190H | Recombinant Human CCR2 Protein | +Inquiry |
RFL4539MF | Recombinant Full Length Mouse C-C Chemokine Receptor Type 2(Ccr2) Protein, His-Tagged | +Inquiry |
CCR2-3954H | Active Recombinant Human CCR2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
Ccr2-4321M | Recombinant Mouse Ccr2 protein, His&Myc-tagged | +Inquiry |
CCR2-0689H | Recombinant Human CCR2 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR2-7696HCL | Recombinant Human CCR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccr2 Products
Required fields are marked with *
My Review for All Ccr2 Products
Required fields are marked with *
0
Inquiry Basket