Recombinant Full Length Mouse Ccr4 Protein, His tagged

Cat.No. : RFL27589MF
Product Overview : Recombinant Full Length Mouse Ccr4 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-360 aa
Description : Enables C-C chemokine receptor activity. Acts upstream of or within several processes, including homeostasis of number of cells; interneuron migration; and tolerance induction. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; gut; limb; liver and biliary system; and reproductive system. Orthologous to human CCR4 (C-C motif chemokine receptor 4).
AASequence : MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVVVLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVGFYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYTEHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRAVRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLNPVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL
Molecular Mass : 42.9 kDa
Purity : ≥85%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from PBS, 0.05% Brij 78,6% Trehalose, pH7.4 The volume before lyophilization is 175μl/vial.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Ccr4 chemokine (C-C motif) receptor 4 [ Mus musculus ]
Official Symbol Ccr4
Synonyms CCR4; chemokine (C-C motif) receptor 4; C-C chemokine receptor type 4; CCR-4; fusin; CC CKR-4; CC-CKR-4; C-C CKR-4; chemokine (C-C) receptor 4; leukocyte-expressed seven-transmembrane-domain receptor; LESTR; Sdf1r; CHEMR1; Cmkbr4; MGC151418;
Gene ID 12773
mRNA Refseq NM_009916
Protein Refseq NP_034046
UniProt ID P51680

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccr4 Products

Required fields are marked with *

My Review for All Ccr4 Products

Required fields are marked with *

0
cart-icon
0
compare icon