Recombinant Full Length Mouse Ccr4 Protein, His tagged

• Cat.No.: RFL27589MF
• Product Overview: Recombinant Full Length Mouse Ccr4 Protein with His tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-360 aa
• Description: Enables C-C chemokine receptor activity. Acts upstream of or within several processes, including homeostasis of number of cells; interneuron migration; and tolerance induction. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; gut; limb; liver and biliary system; and reproductive system. Orthologous to human CCR4 (C-C motif chemokine receptor 4).
• AASequence: MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVVVLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVGFYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYTEHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRAVRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLNPVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL
• Molecular Mass: 42.9 kDa
• Purity: ≥85%, by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from PBS, 0.05% Brij 78,6% Trehalose, pH7.4 The volume before lyophilization is 175μl/vial.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Ccr4 chemokine (C-C motif) receptor 4 [ Mus musculus ]
• Official Symbol: Ccr4
• Synonyms: CCR4; chemokine (C-C motif) receptor 4; C-C chemokine receptor type 4; CCR-4; fusin; CC CKR-4; CC-CKR-4; C-C CKR-4; chemokine (C-C) receptor 4; leukocyte-expressed seven-transmembrane-domain receptor; LESTR; Sdf1r; CHEMR1; Cmkbr4; MGC151418
• Gene ID: 12773
• mRNA Refseq: NM_009916
• Protein Refseq: NP_034046
• UniProt ID: P51680