| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-360 aa |
| Description : |
Enables C-C chemokine receptor activity. Acts upstream of or within several processes, including homeostasis of number of cells; interneuron migration; and tolerance induction. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; gut; limb; liver and biliary system; and reproductive system. Orthologous to human CCR4 (C-C motif chemokine receptor 4). |
| AASequence : |
MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVVVLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVGFYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYTEHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRAVRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLNPVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL |
| Molecular Mass : |
42.9 kDa |
| Purity : |
≥85%, by SDS-PAGE |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : |
Lyophilized from PBS, 0.05% Brij 78,6% Trehalose, pH7.4
The volume before lyophilization is 175μl/vial. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |