Recombinant Full Length Mouse C-C Chemokine Receptor Type 7(Ccr7) Protein, His-Tagged
Cat.No. : | RFL8205MF |
Product Overview : | Recombinant Full Length Mouse C-C chemokine receptor type 7(Ccr7) Protein (P47774) (25-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (25-378) |
Form : | Lyophilized powder |
AA Sequence : | QDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWFLPLMYSVICFVGLLGNGLVILTYI YFKRLKTMTDTYLLNLAVADILFLLILPFWAYSEAKSWIFGVYLCKGIFGIYKLSFFSGM LLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWMLALFLSIPELLYSGLQKNSG EDTLRCSLVSAQVEALITIQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKV IIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCETSKQLNIAYDVTYSLASVRCCVNPF LYAFIGVKFRSDLFKLFKDLGCLSQERLRHWSSCRHVRNASVSMEAETTTTFSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ccr7 |
Synonyms | Ccr7; Cmkbr7; Ebi1; Ebi1h; C-C chemokine receptor type 7; C-C CKR-7; CC-CKR-7; CCR-7; Epstein-Barr virus-induced G-protein coupled receptor 1; EBI1; EBV-induced G-protein coupled receptor 1; MIP-3 beta receptor; CD antigen CD197 |
UniProt ID | P47774 |
◆ Recombinant Proteins | ||
Ccr7-646M | Recombinant Mouse Ccr7 Protein, His-tagged | +Inquiry |
CCR7-0696H | Recombinant Human CCR7 Protein | +Inquiry |
CCR7-213H | Recombinant Human CCR7 Protein, His-tagged | +Inquiry |
CCR7-855H | Active Recombinant Human CCR7 Full Length Transmembrane protein, Flag-tagged(MNP) | +Inquiry |
CCR7-127C | Recombinant Cynomolgus Monkey CCR7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccr7 Products
Required fields are marked with *
My Review for All Ccr7 Products
Required fields are marked with *
0
Inquiry Basket