Recombinant Full Length Mouse C-X-C Chemokine Receptor Type 4(Cxcr4) Protein, His-Tagged
| Cat.No. : | RFL3130MF |
| Product Overview : | Recombinant Full Length Mouse C-X-C chemokine receptor type 4(Cxcr4) Protein (P70658) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-359) |
| Form : | Lyophilized powder |
| AA Sequence : | MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNRIFLPTIYFIIFLTGIVGNGL VILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTV NLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDFIFADVS QGDISQGDDRYICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQ KRKALKTTVILILAFFACWLPYYVGISIDSFILLGVIKQGCDFESIVHKWISITEALAFF HCCLNPILYAFLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cxcr4 |
| Synonyms | Cxcr4; Cmkar4; Lestr; Sdf1r; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin; Leukocyte-derived seven transmembrane domain receptor; LESTR; Pre-B-cell-derived chemokine receptor; PB-CKR; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD an |
| UniProt ID | P70658 |
| ◆ Recombinant Proteins | ||
| RFL31455BF | Recombinant Full Length Bovine C-X-C Chemokine Receptor Type 4(Cxcr4) Protein, His-Tagged | +Inquiry |
| CXCR4-1038H | Active Recombinant Human CXCR4 Full Length Transmembrane protein, His-tagged | +Inquiry |
| CXCR4-6185C | Recombinant Chicken CXCR4 | +Inquiry |
| CXCR4-186H | Recombinant Human CXCR4 Protein, Fc-tagged | +Inquiry |
| CXCR4-1115R | Recombinant Rhesus monkey CXCR4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCR4-7161HCL | Recombinant Human CXCR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcr4 Products
Required fields are marked with *
My Review for All Cxcr4 Products
Required fields are marked with *
