Recombinant Full Length Mouse Cd151 Antigen(Cd151) Protein, His-Tagged
| Cat.No. : | RFL2765MF |
| Product Overview : | Recombinant Full Length Mouse CD151 antigen(Cd151) Protein (O35566) (1-253aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-253) |
| Form : | Lyophilized powder |
| AA Sequence : | MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLAT AYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNT ELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVV PDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd151 |
| Synonyms | Cd151; Peta3; CD151 antigen; GP27; Membrane glycoprotein SFA-1; Platelet-endothelial tetraspan antigen 3; PETA-3; CD antigen CD151 |
| UniProt ID | O35566 |
| ◆ Recombinant Proteins | ||
| CD151-1585R | Recombinant Rhesus Monkey CD151 Protein | +Inquiry |
| CD151-1587R | Recombinant Rhesus Monkey CD151 Protein, hIgG4-tagged | +Inquiry |
| CD151-1586R | Recombinant Rhesus Monkey CD151 Protein, hIgG1-tagged | +Inquiry |
| CD151-2786H | Recombinant Human CD151 protein, His-tagged | +Inquiry |
| RFL11726MF | Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Cd151 Antigen(Cd151) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD151-7684HCL | Recombinant Human CD151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd151 Products
Required fields are marked with *
My Review for All Cd151 Products
Required fields are marked with *
