Recombinant Human CD151 protein, His-tagged
| Cat.No. : | CD151-2786H |
| Product Overview : | Recombinant Human CD151 protein(113-221 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 113-221 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CD151 CD151 molecule (Raph blood group) [ Homo sapiens ] |
| Official Symbol | CD151 |
| Synonyms | CD151; CD151 molecule (Raph blood group); CD151 antigen , CD151 antigen (Raph blood group); CD151 antigen; PETA 3; RAPH; SFA 1; TSPAN24; tspan-24; tetraspanin-24; membrane glycoprotein SFA-1; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; platelet surface glycoprotein gp27; platelet-endothelial tetraspan antigen 3; platelet-endothelial cell tetraspan antigen 3; GP27; MER2; SFA1; PETA-3; |
| Gene ID | 977 |
| mRNA Refseq | NM_001039490 |
| Protein Refseq | NP_001034579 |
| MIM | 602243 |
| UniProt ID | P48509 |
| ◆ Recombinant Proteins | ||
| CD151-0722H | Recombinant Human CD151 Protein | +Inquiry |
| CD151-1236R | Recombinant Rat CD151 Protein | +Inquiry |
| CD151-1585R | Recombinant Rhesus Monkey CD151 Protein | +Inquiry |
| RFL2765MF | Recombinant Full Length Mouse Cd151 Antigen(Cd151) Protein, His-Tagged | +Inquiry |
| CD151-1555Z | Recombinant Zebrafish CD151 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD151-7684HCL | Recombinant Human CD151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD151 Products
Required fields are marked with *
My Review for All CD151 Products
Required fields are marked with *
