Recombinant Full Length Mouse Chloride Channel Clic-Like Protein 1(Clcc1) Protein, His-Tagged
Cat.No. : | RFL14913MF |
Product Overview : | Recombinant Full Length Mouse Chloride channel CLIC-like protein 1(Clcc1) Protein (Q99LI2) (19-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (19-539) |
Form : | Lyophilized powder |
AA Sequence : | HDDDWIDPTDMLNYDAASGTMRKSQVRSGTSEKKEVSPDSSEAEELSDCLHRLDSLTHKV DSCEKKKMKDYESQSNPVFRRYLNKILIEAGKLGLPDENKVEMRYDAEILLSRQTLLEIQ KFLSGEEWKPGALDDALSDILINFKCHDSEAWKWQFEDYFGVDPYNVFMVLLCLLCLVVL VATELWTYVRWYTQMKRIFIISFLLSLAWNWIYLYKMAFAQHQANIAGMEPFDNLCAKKM DWTGSLWEWFTSSWTYKDDPCQKYYELLIVNPIWLVPPTKALAITFTNFVTEPLKHIGKG AGEFIKALMKEIPVLLQIPVLAILALAVLSFCYGAGRSVPMLRHFGGPDREPPRALEPDD RRRQKGLDYRLHGGAGDADFSYRGPAGSIEQGPYDKMHASKRDALRQRFHSGNKSPEVLR AFDLPDTEAQEHPEVVPSHKSPIMNTNLETGELPGESTPTEYSQSAKDVSGQVPSAGKSS PTVDKAQLKTDSECSPPGGCPPSKEAAVAAHGTEPVSSPCG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Clcc1 |
Synonyms | Clcc1; Chloride channel CLIC-like protein 1 |
UniProt ID | Q99LI2 |
◆ Recombinant Proteins | ||
RFL11640XF | Recombinant Full Length Xenopus Laevis Chloride Channel Clic-Like Protein 1(Clcc1) Protein, His-Tagged | +Inquiry |
Clcc1-2177M | Recombinant Mouse Clcc1 Protein, Myc/DDK-tagged | +Inquiry |
RFL13358HF | Recombinant Full Length Human Chloride Channel Clic-Like Protein 1(Clcc1) Protein, His-Tagged | +Inquiry |
CLCC1-1423R | Recombinant Rat CLCC1 Protein | +Inquiry |
CLCC1-1412H | Recombinant Human CLCC1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLCC1-7476HCL | Recombinant Human CLCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Clcc1 Products
Required fields are marked with *
My Review for All Clcc1 Products
Required fields are marked with *
0
Inquiry Basket