Recombinant Full Length Mouse Cmrf35-Like Molecule 6(Cd300C) Protein, His-Tagged
Cat.No. : | RFL5748MF |
Product Overview : | Recombinant Full Length Mouse CMRF35-like molecule 6(Cd300c) Protein (A2A7V7) (22-229aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-229) |
Form : | Lyophilized powder |
AA Sequence : | HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPHFWILVSLKLPLFLSMLGALLWVNRPQRCSGGSSAWPCYENQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd300c |
Synonyms | Cd300c; Clm6; CMRF35-like molecule 6; CLM-6; CD300 antigen-like family member C; CD antigen CD300c |
UniProt ID | A2A7V7 |
◆ Recombinant Proteins | ||
CD300C-0778H | Recombinant Human CD300C Protein | +Inquiry |
CD300C-1038H | Recombinant Human CD300C Protein (Gly21-Arg183), His tagged | +Inquiry |
CD300C-01H | Recombinant Human CD300C Protein, His-Tagged | +Inquiry |
CD300C-3100HF | Recombinant Full Length Human CD300C Protein | +Inquiry |
Cd300c-4533M | Recombinant Mouse Cd300c protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300C-2096HCL | Recombinant Human CD300C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd300c Products
Required fields are marked with *
My Review for All Cd300c Products
Required fields are marked with *
0
Inquiry Basket