Recombinant Full Length Mouse Cytochrome C Oxidase Subunit 6C(Cox6C) Protein, His-Tagged
| Cat.No. : | RFL2858MF |
| Product Overview : | Recombinant Full Length Mouse Cytochrome c oxidase subunit 6C(Cox6c) Protein (Q9CPQ1) (2-76aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-76) |
| Form : | Lyophilized powder |
| AA Sequence : | SSGALLPKPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSMK DFEEMRKAGIFQSAK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cox6c |
| Synonyms | Cox6c; Cytochrome c oxidase subunit 6C; Cytochrome c oxidase polypeptide VIc |
| UniProt ID | Q9CPQ1 |
| ◆ Recombinant Proteins | ||
| COX6C-3821M | Recombinant Mouse COX6C Protein | +Inquiry |
| RFL13798SF | Recombinant Full Length Saimiri Sciureus Cytochrome C Oxidase Subunit 6C(Cox6C) Protein, His-Tagged | +Inquiry |
| COX6C-819R | Recombinant Rhesus Macaque COX6C Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cox6c-622M | Recombinant Mouse Cox6c Protein, His/GST-tagged | +Inquiry |
| Cox6c-929M | Recombinant Mouse Cox6c Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COX6C-7327HCL | Recombinant Human COX6C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cox6c Products
Required fields are marked with *
My Review for All Cox6c Products
Required fields are marked with *
