Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase March4(41337) Protein, His-Tagged
Cat.No. : | RFL19248MF |
Product Overview : | Recombinant Full Length Mouse E3 ubiquitin-protein ligase MARCH4(41337) Protein (Q80TE3) (18-409aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (18-409) |
Form : | Lyophilized powder |
AA Sequence : | WYSCGLCTPAPQMLRHQGLLKCRCRMLFNDLKVFLLRRPPPAPLPMHGDPQLPGVAANNN TLPALGAGGWAGWRGPREAVGRETPPLPPPPPLPPSGDDDWDGPATGPPASLLSSASSDE FCKEKTEDCYSLGSSLDSGMRTPLCRICFQGPEQGELLSPCRCDGSVKCTHQPCLIKWIS ERGCWSCELCYYKYHVIAISTKNPLQWQAISLTVIEKVQIAAAILGSLFLIASISWLIWS TFSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGPSVYRIFKRWQAVNQQWKVLNYD KTKDLEDQKSGGRTNLQTSSSAQANLPSAEEEAASPPAREEGPTRAASHPSGPVSQHHCA YTILHILSHLRPHDQRSTQGSGRELVMRVTTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | March4 |
Synonyms | Marchf4; Kiaa1399; March4; E3 ubiquitin-protein ligase MARCHF4; Membrane-associated RING finger protein 4; Membrane-associated RING-CH protein IV; MARCH-IV; RING-type E3 ubiquitin transferase MARCHF4 |
UniProt ID | Q80TE3 |
◆ Recombinant Proteins | ||
MARCH4-3275Z | Recombinant Zebrafish MARCH4 | +Inquiry |
MARCH4-2680R | Recombinant Rhesus monkey MARCH4 Protein, His-tagged | +Inquiry |
MARCH4-2500R | Recombinant Rhesus Macaque MARCH4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14587DF | Recombinant Full Length Danio Rerio E3 Ubiquitin-Protein Ligase March4(41337) Protein, His-Tagged | +Inquiry |
RFL19248MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase March4(41337) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All March4 Products
Required fields are marked with *
My Review for All March4 Products
Required fields are marked with *