Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Rnf5(Rnf5) Protein, His-Tagged
Cat.No. : | RFL18318MF |
Product Overview : | Recombinant Full Length Mouse E3 ubiquitin-protein ligase RNF5(Rnf5) Protein (O35445) (2-180aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-180) |
Form : | Lyophilized powder |
AA Sequence : | AAAEEEDGGPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDR QECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDAGGFH FSFGVGAFPFGFFTTVFNAHEPFRRGAGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rnf5 |
Synonyms | Rnf5; Ng2; E3 ubiquitin-protein ligase RNF5; RING finger protein 5; RING-type E3 ubiquitin transferase RNF5 |
UniProt ID | O35445 |
◆ Recombinant Proteins | ||
RNF5-5086R | Recombinant Rat RNF5 Protein | +Inquiry |
RNF5-14352M | Recombinant Mouse RNF5 Protein | +Inquiry |
RNF5-4745R | Recombinant Rat RNF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF5-3996H | Recombinant Human RNF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF5-3763R | Recombinant Rhesus Macaque RNF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF5-549HCL | Recombinant Human RNF5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rnf5 Products
Required fields are marked with *
My Review for All Rnf5 Products
Required fields are marked with *
0
Inquiry Basket