Recombinant Full Length Mouse Elongation Of Very Long Chain Fatty Acids Protein 1(Elovl1) Protein, His-Tagged
| Cat.No. : | RFL34318MF | 
| Product Overview : | Recombinant Full Length Mouse Elongation of very long chain fatty acids protein 1(Elovl1) Protein (Q9JLJ5) (1-279aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Mus musculus | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length (1-279) | 
| Form : | Lyophilized powder | 
| AA Sequence : | MEAVVNLYHELMKHADPRIQSYPLMGSPLLITSILLTYVYFILSLGPRIMANRKPFQLRG FMIVYNFSLVILSLYIVYEFLMSGWLSTYTWRCDPIDFSNSPEALRMVRVAWLFMLSKVI ELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYL YYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYG TIFFILFSNFWYHSYTKGKRLPRAVQQNGAPATTKVKAN | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | Elovl1 | 
| Synonyms | Elovl1; Ssc1; Elongation of very long chain fatty acids protein 1; 3-keto acyl-CoA synthase Elovl1; ELOVL fatty acid elongase 1; ELOVL FA elongase 1; Very long chain 3-ketoacyl-CoA synthase 1; Very long chain 3-oxoacyl-CoA synthase 1 | 
| UniProt ID | Q9JLJ5 | 
| ◆ Recombinant Proteins | ||
| ELOVL1-1451R | Recombinant Rhesus monkey ELOVL1 Protein, His-tagged | +Inquiry | 
| ELOVL1-1275R | Recombinant Rhesus Macaque ELOVL1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ELOVL1-2806H | Recombinant Human ELOVL1 Protein, His-tagged, BSA Conjugated | +Inquiry | 
| ELOVL1-1968C | Recombinant Chicken ELOVL1 | +Inquiry | 
| RFL2686HF | Recombinant Full Length Human Elongation Of Very Long Chain Fatty Acids Protein 1(Elovl1) Protein, His-Tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Elovl1 Products
Required fields are marked with *
My Review for All Elovl1 Products
Required fields are marked with *
  
        
    
      
            