Recombinant Full Length Mouse Galactoside 2-Alpha-L-Fucosyltransferase 1(Fut1) Protein, His-Tagged
| Cat.No. : | RFL8881MF |
| Product Overview : | Recombinant Full Length Mouse Galactoside 2-alpha-L-fucosyltransferase 1(Fut1) Protein (O09160) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-376) |
| Form : | Lyophilized powder |
| AA Sequence : | MWTPSRRQLCLTFLLVCVLSAGSFFFHLNGGNFFRNGLTLSVLCSDYHLLKSPVAMVCLPHPLQTSNGSPSCPEQSSSLSGTWTITPGGRFGNQMGQYATLLALAQLNGRQAFIQPEMHAALAPVFRISLPVLDPEVDSLTPWQHLVLHDWMSEEYSHLEDPFLKLSGFPCSWTFFHHLREQIRREFTLHNHLREGAQYLLSGLRIGPASPAHTFVGVHVRRGDYLEVMPNRWKGVVGDRAYLQQAMDWFRARHKDPIFVVTSNGMKWCLENIDTSHGDVVFAGNGQEGTPGKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAAFLPEWVGINADLSPLQAQFDPWKPDSLFRLV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Fut1 |
| Synonyms | Fut1; Galactoside alpha-(1,2-fucosyltransferase 1; Alpha(1,2FT 1; Fucosyltransferase 1; MFUT-1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; Type 1 galactoside alpha-(1,2-fucosyltransferase FUT1; Type 2 galactoside alpha-(1,2-fucosyltra |
| UniProt ID | O09160 |
| ◆ Recombinant Proteins | ||
| FUT1-2411R | Recombinant Rat FUT1 Protein | +Inquiry |
| FUT1-1589R | Recombinant Rhesus Macaque FUT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fut1-1535R | Recombinant Rat Fut1 Protein, His-tagged | +Inquiry |
| FUT1-4557H | Recombinant Human FUT1 Protein, GST-tagged | +Inquiry |
| Fut1-1534M | Recombinant Mouse Fut1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FUT1-6117HCL | Recombinant Human FUT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fut1 Products
Required fields are marked with *
My Review for All Fut1 Products
Required fields are marked with *
