Recombinant Full Length Mouse Galactosylgalactosylxylosylprotein 3-Beta-Glucuronosyltransferase 3(B3Gat3) Protein, His-Tagged
Cat.No. : | RFL18738MF |
Product Overview : | Recombinant Full Length Mouse Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3(B3gat3) Protein (P58158) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQADLRRPPPVPAQPPEPEALPTIYVITPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAESPTPLVSGLLAASGLLFTHLAVLTPKAQRLREGEPGWVRPRGVEQRNKALDWLRGKGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFKEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPNRPFPLDMAGFAVALPLLLAKPNAQFDATAPRGHLESSLLSHLVDPKDLEPRAANCTQVLVWHTRTEKPKMKQEEQLQRQGQGSDPAIEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B3gat3 |
Synonyms | B3gat3; Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3; Beta-1,3-glucuronyltransferase 3; Glucuronosyltransferase I; GlcAT-I; UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase; GlcUAT-I |
UniProt ID | P58158 |
◆ Recombinant Proteins | ||
B3GAT3-228H | Recombinant Human B3GAT3 protein, His-tagged | +Inquiry |
B3GAT3-2238M | Recombinant Mouse B3GAT3 Protein | +Inquiry |
B3GAT3-1717HF | Recombinant Full Length Human B3GAT3 Protein, GST-tagged | +Inquiry |
B3GAT3-2373H | Recombinant Human B3GAT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
B3GAT3-7603H | Recombinant Human B3GAT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GAT3-8545HCL | Recombinant Human B3GAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B3gat3 Products
Required fields are marked with *
My Review for All B3gat3 Products
Required fields are marked with *
0
Inquiry Basket