Recombinant Full Length Mouse Golgi Snap Receptor Complex Member 2(Gosr2) Protein, His-Tagged
Cat.No. : | RFL25800MF |
Product Overview : | Recombinant Full Length Mouse Golgi SNAP receptor complex member 2(Gosr2) Protein (O35166) (1-212aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-212) |
Form : | Lyophilized powder |
AA Sequence : | MEPLYQQTNKQVQEIQSHMGRLERADKQSVHLVENEIQASIEQIFSHLERLEILSSKEPLNRRQNAKLRVDQLKYDVQHLQTALRNFQHRRQVREQQERQRDELLSRTFTTNDSDTTIPMDESLQFNSSLHNIHHGMDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCAVMFLVVQYLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gosr2 |
Synonyms | Gosr2; Gs27; Golgi SNAP receptor complex member 2; 27 kDa Golgi SNARE protein; Membrin |
UniProt ID | O35166 |
◆ Recombinant Proteins | ||
GOSR2-7568H | Recombinant Human GOSR2 protein, His-tagged | +Inquiry |
GOSR2-2622R | Recombinant Rat GOSR2 Protein | +Inquiry |
RFL12056RF | Recombinant Full Length Rat Golgi Snap Receptor Complex Member 2(Gosr2) Protein, His-Tagged | +Inquiry |
GOSR2-167H | Recombinant Human GOSR2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GOSR2-1924R | Recombinant Rhesus monkey GOSR2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOSR2-5826HCL | Recombinant Human GOSR2 293 Cell Lysate | +Inquiry |
GOSR2-5825HCL | Recombinant Human GOSR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gosr2 Products
Required fields are marked with *
My Review for All Gosr2 Products
Required fields are marked with *
0
Inquiry Basket