Recombinant Full Length Mouse Il23a Protein, His&Avi tagged, Biotin Labeled

• Cat.No.: IL23A-03MFL
• Product Overview: IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-23 alpha protein, expressed by HEK293, with C-His, C-Avi labeled tag.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Avi&His
• Protein Length: 1-196 aa
• Conjugation/Label: Biotin
• Description: Contributes to interleukin-23 receptor binding activity. Involved in positive regulation of defense response to virus by host; positive regulation of immune response; and positive regulation of neutrophil chemotaxis. Acts upstream of or within T cell proliferation and positive regulation of transcription by RNA polymerase II. Located in extracellular space. Part of interleukin-23 complex. Is expressed in decidua; decidua basalis; embryo; and extraembryonic component. Orthologous to human IL23A (interleukin 23 subunit alpha).
• Form: Lyophilized powder from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
• Molecular Mass: 23.4 kDa
• AASequence: VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
• Endotoxin: < 1 EU/μg determined by LAL method.
• Purity: > 95% as determined by Tris-Bis PAGE.
• Storage: Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage.
• Shipping: Room temperature in continental US; may vary elsewhere.
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Gene Information

• Gene Name: Il23a interleukin 23, alpha subunit p19 [ Mus musculus (house mouse) ]
• Official Symbol: Il23a
• Synonyms: Il23a; interleukin 23, alpha subunit p19; p19; IL-23; interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; IL-23p19; interleukin-23 subunit p19
• Gene ID: 83430
• mRNA Refseq: NM_031252
• Protein Refseq: NP_112542
• UniProt ID: Q9EQ14

Q&As

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit?

Please inquiry our product manager with specific product.