Recombinant Full Length Mouse Immunoglobulin Superfamily Member 6(Igsf6) Protein, His-Tagged
Cat.No. : | RFL16757MF |
Product Overview : | Recombinant Full Length Mouse Immunoglobulin superfamily member 6(Igsf6) Protein (P0C6B7) (28-237aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (28-237) |
Form : | Lyophilized powder |
AA Sequence : | CTVYVLQPGYLEVDYGSDAVTMECNFSTVGCPPVPPKSLWFRCGTHQPEALCLDGCRNEADKFTVKETLDPDQVFLTVNRLSPNDSAIYICGIAFPNELSPSAKHVGKGTTLVVRERLFSKEVRSFLIVLLALLSVYITGVCVTFIVLFKSKSNGPRSRETKGSKKKSARRIFQEIAQELYHKRYVETSHLPEQEGTDENRKALPNPGRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Igsf6 |
Synonyms | Igsf6; Immunoglobulin superfamily member 6; IgSF6 |
UniProt ID | P0C6B7 |
◆ Recombinant Proteins | ||
IGSF6-4481M | Recombinant Mouse IGSF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGSF6-2672R | Recombinant Rat IGSF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGSF6-4981C | Recombinant Chicken IGSF6 | +Inquiry |
RFL2859HF | Recombinant Full Length Human Immunoglobulin Superfamily Member 6(Igsf6) Protein, His-Tagged | +Inquiry |
Igsf6-3495M | Recombinant Mouse Igsf6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGSF6-5255HCL | Recombinant Human IGSF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Igsf6 Products
Required fields are marked with *
My Review for All Igsf6 Products
Required fields are marked with *
0
Inquiry Basket