Recombinant Full Length Mouse Integral Membrane Protein Gpr137B(Gpr137B) Protein, His-Tagged
Cat.No. : | RFL5474MF |
Product Overview : | Recombinant Full Length Mouse Integral membrane protein GPR137B(Gpr137b) Protein (Q8BNQ3) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MEAPPWEPVRNDSLPPTLSPAVPPYVKLGLTAVYTVFYALLFVFIYAQLWLVLRYRHKRL SYQSVFLFLCLFWASLRTVLFSFYFRDFVAANSFSPFVFWLLYCFPVCLQFFTLTLMNLY FTQVIFKAKSKYSPELLKYRLPLYLASLFISLVFLLVNLTCAVLVKTGDWDRKVIVSVRV AINDTLFVLCAISLSICLYKISKMSLANIYLESKGSSVCQVTAIGVTVILLYTSRACYNL FILSFSQIKNVHSFDYDWYNVSDQADLKSQLGDAGYVVFGVVLFVWELLPTTLVVYFFRV RNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGSFAPDYCDWGQQ NNSFLAQAGTLHQDSTLDPDKASQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr137b |
Synonyms | Gpr137b; Tm7sf1; Integral membrane protein GPR137B; Transmembrane 7 superfamily member 1 protein |
UniProt ID | Q8BNQ3 |
◆ Recombinant Proteins | ||
GPR137B-3850M | Recombinant Mouse GPR137B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33187HF | Recombinant Full Length Human Integral Membrane Protein Gpr137B(Gpr137B) Protein, His-Tagged | +Inquiry |
GPR137B-7143M | Recombinant Mouse GPR137B Protein | +Inquiry |
RFL14584XF | Recombinant Full Length Xenopus Laevis Integral Membrane Protein Gpr137B(Gpr137B) Protein, His-Tagged | +Inquiry |
GPR137B-2742C | Recombinant Chicken GPR137B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gpr137b Products
Required fields are marked with *
My Review for All Gpr137b Products
Required fields are marked with *
0
Inquiry Basket