Recombinant Full Length Mouse Interferon Alpha-Inducible Protein 27-Like Protein 2A(Ifi27L2A) Protein, His-Tagged
| Cat.No. : | RFL23430MF |
| Product Overview : | Recombinant Full Length Mouse Interferon alpha-inducible protein 27-like protein 2A(Ifi27l2a) Protein (Q8R412) (25-90aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (25-90) |
| Form : | Lyophilized powder |
| AA Sequence : | AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGA AVGALL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Ifi27l2a |
| Synonyms | Ifi27l2a; Ifi27; Isg12; Interferon alpha-inducible protein 27-like protein 2A; Interferon-stimulated gene 12 protein; ISG12 |
| UniProt ID | Q8R412 |
| ◆ Recombinant Proteins | ||
| Ifi27l2a-1213M | Recombinant Mouse Ifi27l2a Full Length Transmembrane protein, His-tagged | +Inquiry |
| IFI27L2A-4427M | Recombinant Mouse IFI27L2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| IFI27L2A-8007M | Recombinant Mouse IFI27L2A Protein | +Inquiry |
| RFL23430MF | Recombinant Full Length Mouse Interferon Alpha-Inducible Protein 27-Like Protein 2A(Ifi27L2A) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifi27l2a Products
Required fields are marked with *
My Review for All Ifi27l2a Products
Required fields are marked with *
