Recombinant Full Length Mouse Interleukin-11 Receptor Subunit Alpha-2(Il11Ra2) Protein, His-Tagged
Cat.No. : | RFL13133MF |
Product Overview : | Recombinant Full Length Mouse Interleukin-11 receptor subunit alpha-2(Il11ra2) Protein (P70225) (24-432aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-432) |
Form : | Lyophilized powder |
AA Sequence : | SPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDTVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGLLQDEIPDWSQGHGQQLEAVVAQEDSLAPARPSLQPDPRPLDHRDPLEQVAVLASLGIFSCLGLAVGALALGLWLRLRRSGKEGPQKPGLLAPMIPVEKLPGIPNLQRTPENFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Il11ra2 |
Synonyms | Il11ra2; Interleukin-11 receptor subunit alpha-2; IL-11 receptor subunit alpha-2; IL-11R subunit alpha-2; IL-11R-alpha-2; IL-11RA2; Interleukin-11 receptor subunit beta; IL-11 receptor subunit beta; IL-11R subunit beta; IL-11R-beta; IL-11RB |
UniProt ID | P70225 |
◆ Recombinant Proteins | ||
IL11RA2-8112M | Recombinant Mouse IL11RA2 Protein | +Inquiry |
RFL13133MF | Recombinant Full Length Mouse Interleukin-11 Receptor Subunit Alpha-2(Il11Ra2) Protein, His-Tagged | +Inquiry |
IL11RA2-4491M | Recombinant Mouse IL11RA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il11ra2 Products
Required fields are marked with *
My Review for All Il11ra2 Products
Required fields are marked with *
0
Inquiry Basket