Recombinant Full Length Mouse Interleukin-3 Receptor Subunit Alpha(Il3Ra) Protein, His-Tagged
Cat.No. : | RFL34156MF |
Product Overview : | Recombinant Full Length Mouse Interleukin-3 receptor subunit alpha(Il3ra) Protein (P26952) (17-396aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (17-396) |
Form : | Lyophilized powder |
AA Sequence : | SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLLYRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Il3ra |
Synonyms | Il3ra; Sut-1; Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; Interleukin-3 receptor class II alpha chain; CD antigen CD123 |
UniProt ID | P26952 |
◆ Recombinant Proteins | ||
IL3RA-29795TH | Recombinant Human IL3RA, Fc-tagged | +Inquiry |
IL3RA-440H | Recombinant Human IL3RA | +Inquiry |
IL3RA-151H | Recombinant Human IL3RA Protein, DYKDDDDK-tagged | +Inquiry |
IL3RA-1556R | Recombinant Rhesus Monkey IL3RA Protein | +Inquiry |
IL3RA-420H | Recombinant Human IL3RA, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3RA-742CCL | Recombinant Canine IL3RA cell lysate | +Inquiry |
IL3RA-2433HCL | Recombinant Human IL3RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il3ra Products
Required fields are marked with *
My Review for All Il3ra Products
Required fields are marked with *
0
Inquiry Basket