Recombinant Full Length Mouse Junctional Adhesion Molecule A(F11R) Protein, His-Tagged
Cat.No. : | RFL6663MF |
Product Overview : | Recombinant Full Length Mouse Junctional adhesion molecule A(F11r) Protein (O88792) (27-300aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-300) |
Form : | Lyophilized powder |
AA Sequence : | KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F11r |
Synonyms | F11r; Jam1; Jcam; Jcam1; Junctional adhesion molecule A; JAM-A; Junctional adhesion molecule 1; JAM-1; CD antigen CD321 |
UniProt ID | O88792 |
◆ Recombinant Proteins | ||
F11R-6785H | Recombinant Human F11 Receptor, His-tagged | +Inquiry |
F11R-1044H | Recombinant Human F11R protein(Gln24-Tyr213), hFc-tagged | +Inquiry |
F11R-1732R | Recombinant Rhesus Monkey F11R Protein, hIgG1-tagged | +Inquiry |
F11r-8744R | Recombinant Rat F11r protein(Met1-Gly238), His-tagged | +Inquiry |
F11R-1285H | Recombinant Human F11R protein, hFc&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F11R-2127MCL | Recombinant Mouse F11R cell lysate | +Inquiry |
F11R-1437RCL | Recombinant Rat F11R cell lysate | +Inquiry |
F11R-2741HCL | Recombinant Human F11R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F11r Products
Required fields are marked with *
My Review for All F11r Products
Required fields are marked with *