Recombinant Full Length Mouse Lactosylceramide Alpha-2,3-Sialyltransferase(St3Gal5) Protein, His-Tagged
Cat.No. : | RFL27799MF |
Product Overview : | Recombinant Full Length Mouse Lactosylceramide alpha-2,3-sialyltransferase(St3gal5) Protein (O88829) (1-414aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-414) |
Form : | Lyophilized powder |
AA Sequence : | MHTEAVGGAARRPQKLRSQAAAPACRAMPSEFTSAKLRSDCSRTSLQWYTRTQHKMRRPSLLIKDICKCTLVAFGVWLLYILILNYTAEECDMKRMHYVDPDRIKRAQSYAQEVLQKECRPRYAKTAMALLFEDRYSINLEPFVQKVPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKACKRCVVVGNGGILHGLELGHALNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDVEYYANDLFVTVLFKSVDFKWLQAMVKNESLPFWVRLFFWKQVAEKVPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGVIAVVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMHWQVMHNVTTETKFLLKLLKEGVVEDLSGGIH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | St3gal5 |
Synonyms | St3gal5; GM3S; Siat9; Lactosylceramide alpha-2,3-sialyltransferase; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; Ganglioside GM3 synthase; ST3Gal V; ST3GalV; Sialyltransferase 9 |
UniProt ID | O88829 |
◆ Recombinant Proteins | ||
ST3GAL5-9925Z | Recombinant Zebrafish ST3GAL5 | +Inquiry |
RFL27799MF | Recombinant Full Length Mouse Lactosylceramide Alpha-2,3-Sialyltransferase(St3Gal5) Protein, His-Tagged | +Inquiry |
ST3GAL5-16066M | Recombinant Mouse ST3GAL5 Protein | +Inquiry |
ST3GAL5-335H | Recombinant Human ST3 beta-galactoside alpha-2,3-sialyltransferase 5, His-tagged | +Inquiry |
ST3GAL5-4500R | Recombinant Rhesus monkey ST3GAL5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST3GAL5-1440HCL | Recombinant Human ST3GAL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All St3gal5 Products
Required fields are marked with *
My Review for All St3gal5 Products
Required fields are marked with *
0
Inquiry Basket