Recombinant Full Length Mouse Lysophospholipid Acyltransferase Lpcat4(Lpcat4) Protein, His-Tagged
Cat.No. : | RFL5043MF |
Product Overview : | Recombinant Full Length Mouse Lysophospholipid acyltransferase LPCAT4(Lpcat4) Protein (Q6NVG1) (1-524aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-524) |
Form : | Lyophilized powder |
AA Sequence : | MSQGSPGAWAPLDPTSGSSASPNPFVHELHLSGLQRVKFCLLGVLLAPIRVLLAFIVLFL LWPFAWLQVAGLTEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLE APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYQPSLEESKDPTLYANNVQRVMAQALGIP ATECEFVGSLPVIVVGQLKVALEPQLWELAKVLQKAGLSPGFVDMGAEPGRSRMISQEAF AQQLQLSDPQTVAGAFSYFQQDAKGLVDFRNVALALAALDGGRSLEELTRLAFELFAEEQ AEGSDRLLYKDGFSTILHLLLGSPRPAATTLHAELCQPGCSQGLSLCQFQNFSLHDPLYG KLFSAYLRPPHKPRSTSQIPNASSPSSPTALANGTVQAPKQKGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lpcat4 |
Synonyms | Lpcat4; Agpat7; Aytl3; Lysophospholipid acyltransferase LPCAT4; 1-acylglycerol-3-phosphate O-acyltransferase 7; 1-AGP acyltransferase 7; 1-AGPAT 7; 1-acylglycerophosphocholine O-acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; 1-alkenylglyce |
UniProt ID | Q6NVG1 |
◆ Recombinant Proteins | ||
LPCAT4-935HF | Recombinant Full Length Human LPCAT4 Protein, GST-tagged | +Inquiry |
LPCAT4-437H | Recombinant Human LPCAT4 Protein, GST-tagged | +Inquiry |
RFL4531XF | Recombinant Full Length Xenopus Laevis Lysophospholipid Acyltransferase Lpcat4(Lpcat4) Protein, His-Tagged | +Inquiry |
LPCAT4-11603Z | Recombinant Zebrafish LPCAT4 | +Inquiry |
LPCAT4-3867H | Recombinant Human LPCAT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPCAT4-4670HCL | Recombinant Human LPCAT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lpcat4 Products
Required fields are marked with *
My Review for All Lpcat4 Products
Required fields are marked with *
0
Inquiry Basket