Recombinant Full Length Mouse Membrane-Associated Progesterone Receptor Component 2(Pgrmc2) Protein, His-Tagged
Cat.No. : | RFL12347MF |
Product Overview : | Recombinant Full Length Mouse Membrane-associated progesterone receptor component 2(Pgrmc2) Protein (Q80UU9) (1-217aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-217) |
Form : | Lyophilized powder |
AA Sequence : | MAAGDGDVKLSTLGSGGESGGDGSPGGAGATAARSSWVAALLATGGEMLLNVALVALVLL GAYRLWVRWGRRGLCSGPGAGEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGK VFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREW EMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHSKQD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pgrmc2 |
Synonyms | Pgrmc2; Membrane-associated progesterone receptor component 2 |
UniProt ID | Q80UU9 |
◆ Recombinant Proteins | ||
PGRMC2-5883H | Recombinant Human PGRMC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PGRMC2-12328Z | Recombinant Zebrafish PGRMC2 | +Inquiry |
PGRMC2-12701M | Recombinant Mouse Pgrmc2 Protein, Myc/DDK-tagged | +Inquiry |
PGRMC2-1581C | Recombinant Chicken PGRMC2 | +Inquiry |
RFL29459RF | Recombinant Full Length Rat Membrane-Associated Progesterone Receptor Component 2(Pgrmc2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGRMC2-3247HCL | Recombinant Human PGRMC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pgrmc2 Products
Required fields are marked with *
My Review for All Pgrmc2 Products
Required fields are marked with *
0
Inquiry Basket