Recombinant Full Length Mouse Neural Proliferation Differentiation And Control Protein 1(Npdc1) Protein, His-Tagged
Cat.No. : | RFL5890MF |
Product Overview : | Recombinant Full Length Mouse Neural proliferation differentiation and control protein 1(Npdc1) Protein (Q64322) (35-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (35-332) |
Form : | Lyophilized powder |
AA Sequence : | RRPDATTCPGSLDCALKRRAKCPPGAHACGPCLQSFQEDQRGFCVPRKHLSSGEGLPQPR LEEEIDSLAQELALKEKEAGHSRLTAQPLLEAAQKLLEPAATLGFSQWGQRLEPGLPSTH GTSSPIPHTSLSSRASSGPVQMSPLEPQGRHGNGLTLVLILAFCLASSAALAVAALCWCR LQREIRLTQKADYAATAKGPTSPSTPRISPGDQRLAHSAEMYHYQHQRQQMLCLERHKEP PKELESASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHSTLSAPVPGPHSLPPLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Npdc1 |
Synonyms | Npdc1; Npdc-1; Neural proliferation differentiation and control protein 1; NPDC-1 |
UniProt ID | Q64322 |
◆ Recombinant Proteins | ||
NPDC1-935H | Recombinant Human NPDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NPDC1-1339H | Recombinant Human NPDC1, GST-tagged | +Inquiry |
NPDC1-1271H | Recombinant Human NPDC1 Protein, MYC/DDK-tagged | +Inquiry |
NPDC1-572H | Recombinant Human NPDC1 Protein, His-tagged | +Inquiry |
NPDC1-049H | Recombinant Human NPDC1 Protein, HIS-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPDC1-752HCL | Recombinant Human NPDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Npdc1 Products
Required fields are marked with *
My Review for All Npdc1 Products
Required fields are marked with *
0
Inquiry Basket