Recombinant Full Length Mouse Nkg2-D Type Ii Integral Membrane Protein(Klrk1) Protein, His-Tagged
| Cat.No. : | RFL29110MF |
| Product Overview : | Recombinant Full Length Mouse NKG2-D type II integral membrane protein(Klrk1) Protein (O54709) (1-232aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-232) |
| Form : | Lyophilized powder |
| AA Sequence : | MALIRDRKSHHSEMSKCHNYDLKPAKWDTSQEQQKQRLALTTSQPGENGIIRGRYPIEKLKISPMFVVRVLAIALAIRFTLNTLMWLAIFKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Klrk1 |
| Synonyms | Klrk1; Nkg2d; NKG2-D type II integral membrane protein; Killer cell lectin-like receptor subfamily K member 1; NK cell receptor D; NKG2-D-activating NK receptor; CD antigen CD314 |
| UniProt ID | O54709 |
| ◆ Recombinant Proteins | ||
| KLRK1-392C | Recombinant Cynomolgus Monkey KLRK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KLRK1-5673H | Active Recombinant Human Killer Cell Lectin-Like Receptor Subfamily K, Member 1, Fc-tagged | +Inquiry |
| KLRK1-718HB | Recombinant Human KLRK1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| KLRK1-1055M | Recombinant Mouse KLRK1 protein(Phe77-Val219), hFc-tagged | +Inquiry |
| KLRK1-8790M | Recombinant Mouse KLRK1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLRK1-001CCL | Recombinant Cynomolgus KLRK1 cell lysate | +Inquiry |
| KLRK1-002HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
| KLRK1-001HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Klrk1 Products
Required fields are marked with *
My Review for All Klrk1 Products
Required fields are marked with *



