Recombinant Full Length Mouse P2Y Purinoceptor 14(P2Ry14) Protein, His-Tagged
| Cat.No. : | RFL29937MF |
| Product Overview : | Recombinant Full Length Mouse P2Y purinoceptor 14(P2ry14) Protein (Q9ESG6) (1-338aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-338) |
| Form : | Lyophilized powder |
| AA Sequence : | MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYL KNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRY YKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELG RKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVL VFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQ PFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | P2ry14 |
| Synonyms | P2ry14; Gpr105; P2Y purinoceptor 14; P2Y14; G-protein coupled receptor 105; UDP-glucose receptor |
| UniProt ID | Q9ESG6 |
| ◆ Recombinant Proteins | ||
| P2RY14-4236R | Recombinant Rat P2RY14 Protein | +Inquiry |
| RFL3166RF | Recombinant Full Length Rat P2Y Purinoceptor 14(P2Ry14) Protein, His-Tagged | +Inquiry |
| P2RY14-392H | Recombinant Human P2RY14 Protein, His-tagged | +Inquiry |
| P2RY14-5378H | Recombinant Human P2RY14 Protein (Pro51-Arg303), His tagged | +Inquiry |
| RFL6634BF | Recombinant Full Length Bovine P2Y Purinoceptor 14(P2Ry14) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| P2RY14-3488HCL | Recombinant Human P2RY14 293 Cell Lysate | +Inquiry |
| P2RY14-3489HCL | Recombinant Human P2RY14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All P2ry14 Products
Required fields are marked with *
My Review for All P2ry14 Products
Required fields are marked with *
