Recombinant Full Length Mouse Peripheral Myelin Protein 22(Pmp22) Protein, His-Tagged
Cat.No. : | RFL7720MF |
Product Overview : | Recombinant Full Length Mouse Peripheral myelin protein 22(Pmp22) Protein (P16646) (1-161aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-161) |
Form : | Lyophilized powder |
AA Sequence : | MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHTTDLWQNCTTSALGAVQHCYSSSVSE WLQSVQATMILSVIFSVLALFLFFCQLFTLTKGGRFYITGFFQILAGLCVMSAAAIYTVR HSEWHVNTDYSYGFAYILAWVAFPLALLSGIIYVILRKREL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pmp22 |
Synonyms | Pmp22; Gas-3; Gas3; Pmp-22; Peripheral myelin protein 22; PMP-22; Growth arrest-specific protein 3; GAS-3 |
UniProt ID | P16646 |
◆ Recombinant Proteins | ||
PMP22-4473H | Recombinant Human PMP22 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PMP22-1718H | Recombinant Human PMP22 Protein, His (Fc)-Avi-tagged | +Inquiry |
PMP22-4202R | Recombinant Rat PMP22 Protein, His (Fc)-Avi-tagged | +Inquiry |
PMP22-374HF | Recombinant Full Length Human PMP22 Protein | +Inquiry |
PMP22-2147H | Recombinant Human PMP22 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pmp22 Products
Required fields are marked with *
My Review for All Pmp22 Products
Required fields are marked with *