Recombinant Full Length Mouse Peroxisomal Membrane Protein Pmp34(Slc25A17) Protein, His-Tagged
Cat.No. : | RFL33628MF |
Product Overview : | Recombinant Full Length Mouse Peroxisomal membrane protein PMP34(Slc25a17) Protein (O70579) (1-307aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-307) |
Form : | Lyophilized powder |
AA Sequence : | MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHAVLLEIIKEEG LLAPYRGWFPVISSLCCSNFVYFYTFNSLKAVWVKGQRSSTGKDLVVGFVAGVVNVLLTT PLWVVNTRLKLQGAKFRNEDIIPTNYKGIIDAFHQIIRDEGILALWNGTFPSLLLVFNPA IQFMFYEGLKRQLLKKRMKLSSLDVFIIGAIAKAIATTVTYPMQTVQSILRFGRHRLNPE NRTLGSLRNVLSLLHQRVKRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMG LKSTHKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc25a17 |
Synonyms | Slc25a17; Pmp34; Pmp35; Peroxisomal membrane protein PMP34; 34 kDa peroxisomal membrane protein; Solute carrier family 25 member 17 |
UniProt ID | O70579 |
◆ Recombinant Proteins | ||
SLC25A17-15302M | Recombinant Mouse SLC25A17 Protein | +Inquiry |
SLC25A17-4060R | Recombinant Rhesus Macaque SLC25A17 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL16321HF | Recombinant Full Length Human Peroxisomal Membrane Protein Pmp34(Slc25A17) Protein, His-Tagged | +Inquiry |
SLC25A17-8273M | Recombinant Mouse SLC25A17 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A17-5756Z | Recombinant Zebrafish SLC25A17 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Slc25a17 Products
Required fields are marked with *
My Review for All Slc25a17 Products
Required fields are marked with *
0
Inquiry Basket