Recombinant Full Length Mouse Platelet Glycoprotein Ix(Gp9) Protein, His-Tagged
Cat.No. : | RFL23623MF |
Product Overview : | Recombinant Full Length Mouse Platelet glycoprotein IX(Gp9) Protein (O88186) (17-177aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (17-177) |
Form : | Lyophilized powder |
AA Sequence : | TQACPRPCTCQSLETMGLKVNCEGQGLTALPVIPAHTRQLLLANNSLRSVPPGAFDHLPQLWDLDVTHNPWHCDCSLTYLRLWLEDHMPEALMHVYCASPDLATRRPLGQLTGYELGSCGWKLPPSWAYPGVWWDVSLVAVAVLGLILLAGLLNTFTESRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gp9 |
Synonyms | Gp9; Platelet glycoprotein IX; GP-IX; GPIX; Glycoprotein 9; CD antigen CD42a |
UniProt ID | O88186 |
◆ Recombinant Proteins | ||
GP9-1925R | Recombinant Rhesus monkey GP9 Protein, His-tagged | +Inquiry |
GP9-5466HF | Recombinant Full Length Human GP9 Protein, GST-tagged | +Inquiry |
GP9-3810M | Recombinant Mouse GP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
GP9-5133H | Recombinant Human GP9 Protein, GST-tagged | +Inquiry |
GP9-823H | Recombinant Human GP9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GP9-5820HCL | Recombinant Human GP9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gp9 Products
Required fields are marked with *
My Review for All Gp9 Products
Required fields are marked with *
0
Inquiry Basket