Recombinant Full Length Mouse Potassium Channel Subfamily K Member 13(Kcnk13) Protein, His-Tagged
Cat.No. : | RFL4680MF |
Product Overview : | Recombinant Full Length Mouse Potassium channel subfamily K member 13(Kcnk13) Protein (Q8R1P5) (1-405aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-405) |
Form : | Lyophilized powder |
AA Sequence : | MAGRGCGCSPGHLNEDNARFLLLAGLILLYLLGGAAVFSALELAQELQAKQRWEERLANF SRGHNLSREELRGFLRHYEEATRAGIRMDSVRPRWDFTGAFYFVGTVVSTIGFGMTTPAT TGGKIFLIFYGLIGCASTILFFNLFLERLITVIACVMRSCHQQQLRRRGAVTQDNMKAPE KGEADSLTGWKPSVYYVMLILCLASVAISCGASALYTTMEGWSYFDSVYFCFVAFSTIGF GDLVSSQNAQYESQGLYRFFNFFLILMGVCCIYSLFNVISILIKQTVNWILRKLDSGCFP PCQRGLLRSRRNVVMPGNIRNRCNISIETDGVMESDTDGRRLSGEMISMKDTNKVSLAIL QKQLSEMANGGPHQNSASSRDDEFSGGVGAFAVMNNRLAETSGDR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnk13 |
Synonyms | Kcnk13; Gm1570; Potassium channel subfamily K member 13; Tandem pore domain halothane-inhibited potassium channel 1; THIK-1 |
UniProt ID | Q8R1P5 |
◆ Recombinant Proteins | ||
KCNK13-2184R | Recombinant Rhesus Macaque KCNK13 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNK13-1211H | Recombinant Human KCNK13 Full Length Transmembrane protein, His-tagged | +Inquiry |
KCNK13-2363R | Recombinant Rhesus monkey KCNK13 Protein, His-tagged | +Inquiry |
RFL4680MF | Recombinant Full Length Mouse Potassium Channel Subfamily K Member 13(Kcnk13) Protein, His-Tagged | +Inquiry |
KCNK13-3209R | Recombinant Rat KCNK13 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK13-89HCL | Recombinant Human KCNK13 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kcnk13 Products
Required fields are marked with *
My Review for All Kcnk13 Products
Required fields are marked with *
0
Inquiry Basket