Recombinant Full Length Mouse Potassium Voltage-Gated Channel Subfamily G Member 1(Kcng1) Protein, His-Tagged
Cat.No. : | RFL21714MF |
Product Overview : | Recombinant Full Length Mouse Potassium voltage-gated channel subfamily G member 1(Kcng1) Protein (A2BDX4) (1-514aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-514) |
Form : | Lyophilized powder |
AA Sequence : | MTLLPGDNSHYDYSALSCASDTSFHPAFFPQRQAIKGVFYRRAQRLRPQDDLHQSCSLGD RRRQIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILSVCDDYDVTCNEFFFDRN PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMM EREEEEEPLDSEDQESEGPSASEGRLSRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT AVNLSVSTLPSLREEEEQGQCSQMCHNVFIVESVCVGWFSLEFLLRFIQAPSKFAFLRSP LTLIDLVAILPYYVTLLVDGAASSRRKPSTGNSYLDKVGLVLRVLRALRILYVMRLARHS LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVLIR RAQYLIKTKSQLSGMSQDSDILFGSASSDTRDNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcng1 |
Synonyms | Kcng1; Potassium voltage-gated channel subfamily G member 1; Voltage-gated potassium channel subunit Kv6.1 |
UniProt ID | A2BDX4 |
◆ Recombinant Proteins | ||
KCNG1-662H | Recombinant Human KCNG1 | +Inquiry |
KCNG1-244H | Recombinant Human KCNG1, GST-tagged | +Inquiry |
KCNG1-6166Z | Recombinant Zebrafish KCNG1 | +Inquiry |
RFL6593HF | Recombinant Full Length Human Potassium Voltage-Gated Channel Subfamily G Member 1(Kcng1) Protein, His-Tagged | +Inquiry |
KCNG1-3192H | Recombinant Human KCNG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kcng1 Products
Required fields are marked with *
My Review for All Kcng1 Products
Required fields are marked with *
0
Inquiry Basket