Recombinant Full Length Mouse Pra1 Family Protein 3(Arl6Ip5) Protein, His-Tagged
| Cat.No. : | RFL12644MF |
| Product Overview : | Recombinant Full Length Mouse PRA1 family protein 3(Arl6ip5) Protein (Q8R5J9) (1-188aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-188) |
| Form : | Lyophilized powder |
| AA Sequence : | MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGVIVVLVFMGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVM VFVFGITLPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDNINKFA DYISKARE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Arl6ip5 |
| Synonyms | Arl6ip5; Aip5; Jwa; Pra2; Praf3; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5; Addicsin; GTRAP3-18; Glutamate transporter EAAC1-interacting protein; Prenylated Rab acceptor protein |
| UniProt ID | Q8R5J9 |
| ◆ Recombinant Proteins | ||
| ARL6IP5-728M | Recombinant Mouse ARL6IP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARL6IP5-442R | Recombinant Rat ARL6IP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARL6IP5-404R | Recombinant Rhesus monkey ARL6IP5 Protein, His-tagged | +Inquiry |
| ARL6IP5-1975C | Recombinant Chicken ARL6IP5 | +Inquiry |
| RFL18996RF | Recombinant Full Length Rat Pra1 Family Protein 3(Arl6Ip5) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL6IP5-36HCL | Recombinant Human ARL6IP5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Arl6ip5 Products
Required fields are marked with *
My Review for All Arl6ip5 Products
Required fields are marked with *



