Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 151 Protein(Gpr151) Protein, His-Tagged
Cat.No. : | RFL29728MF |
Product Overview : | Recombinant Full Length Mouse Probable G-protein coupled receptor 151 protein(Gpr151) Protein (Q7TSN6) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MGKAMLRAGFADTNSSNMNESFARLHFAGGYLPSDSKDWRTIIPSLLMAVCLVGLVGNLC VIGILLHGVWKRKPSTIHSLILNLSLADFSLLLFSAPVRAAAYSKGVWDLGWFICKSSDW FTHVCMAAKSLTFVVVAKACFAYASDPAKQESIHSRTIWSVLAGIWVVASLLPLPEWLFS TTRRHAGVEMCLVDVPAVAEEFMSMFGKLYPLLVFCLPLLLAGVYFWRAYDQCKTRCTKT RNLRDQMRSKQLTVMLLSTAIISALLWLPEWIAWLWVWHVKAGGPMPPQGFIALSQVLMF FTSTANPLIFLVMSEEFKAGLKGLWKWMITRKPAVTSEVQEAPAGNTEALPGKAPSPETQ TCILDTDGRGSPDDSKEKSGKVVAPILPDVEQFWHERDAVPSAQDNDPIPWEHEGQETEG CN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr151 |
Synonyms | Gpr151; Pgr7; G-protein coupled receptor 151 protein; G-protein coupled receptor PGR7; GPCR-2037 |
UniProt ID | Q7TSN6 |
◆ Recombinant Proteins | ||
GPR151-3859M | Recombinant Mouse GPR151 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20620RF | Recombinant Full Length Rat Probable G-Protein Coupled Receptor 151(Gpr151) Protein, His-Tagged | +Inquiry |
RFL29728MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 151 Protein(Gpr151) Protein, His-Tagged | +Inquiry |
GPR151-3850C | Recombinant Chicken GPR151 | +Inquiry |
GPR151-5647HF | Recombinant Full Length Human GPR151 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR151-740HCL | Recombinant Human GPR151 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gpr151 Products
Required fields are marked with *
My Review for All Gpr151 Products
Required fields are marked with *
0
Inquiry Basket