Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 171(Gpr171) Protein, His-Tagged
Cat.No. : | RFL21936MF |
Product Overview : | Recombinant Full Length Mouse Probable G-protein coupled receptor 171(Gpr171) Protein (Q8BG55) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MTNSSTFCPVYRDLEPFTYFFYLVFLIGIIGSCFATWAFIQKTTNHRCVSIYLINLLTAD FLLTLALPVKIIVDLGVAPWKLRIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLIHSC KIYRIQEPGFAKMISAVVWLMVLLIMVPNMVIPIKDIKEKSNVGCMEFKKEFGRNWHLLT NFICVAIFLNFSVIILISNFLAIRQLYRNRDNTNYPSVKSALLHILLVTASYIICFVPYH AVRIPYTLSQTEVISDCSTRIALFKAKEATLLLAVSNLCFDPILYYHLSKAFRLKVTETF ASPKKSKPLEERLRSENDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr171 |
Synonyms | Gpr171; Probable G-protein coupled receptor 171 |
UniProt ID | Q8BG55 |
◆ Recombinant Proteins | ||
GPR171-1947R | Recombinant Rhesus monkey GPR171 Protein, His-tagged | +Inquiry |
GPR171-3694H | Recombinant Human GPR171 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPR171-1768R | Recombinant Rhesus Macaque GPR171 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR171-7164M | Recombinant Mouse GPR171 Protein | +Inquiry |
RFL21936MF | Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 171(Gpr171) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR171-305HCL | Recombinant Human GPR171 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gpr171 Products
Required fields are marked with *
My Review for All Gpr171 Products
Required fields are marked with *
0
Inquiry Basket