Recombinant Full Length Mouse Prostasin(Prss8) Protein, His-Tagged
Cat.No. : | RFL25970MF |
Product Overview : | Recombinant Full Length Mouse Prostasin(Prss8) Protein (Q9ESD1) (45-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (45-322) |
Form : | Lyophilized powder |
AA Sequence : | ITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAHQ LDSYSNDTVVHTVAQIITHSSYREEGSQGDIAFIRLSSPVTFSRYIRPICLPAANASFPN GLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCA GYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHH VAELQPRVVPQTQESQPDGHLCNHHPVFSSAAAPKLLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Prss8 |
Synonyms | Prss8; Cap1; Prostasin; Channel-activating protease 1; CAP1; Serine protease 8 |
UniProt ID | Q9ESD1 |
◆ Recombinant Proteins | ||
PRSS8-518H | Active Recombinant Human PRSS8 Protein, His-tagged | +Inquiry |
RFL25970MF | Recombinant Full Length Mouse Prostasin(Prss8) Protein, His-Tagged | +Inquiry |
Prss8-6779M | Recombinant Mouse Prss8 Protein (Ala30-Gln289), C-Fc tagged | +Inquiry |
PRSS8-3641R | Recombinant Rhesus monkey PRSS8 Protein, His-tagged | +Inquiry |
PRSS8-4752R | Recombinant Rat PRSS8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRSS8-441MCL | Recombinant Mouse PRSS8 cell lysate | +Inquiry |
PRSS8-2865HCL | Recombinant Human PRSS8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Prss8 Products
Required fields are marked with *
My Review for All Prss8 Products
Required fields are marked with *