Recombinant Human PRSS8 protein, His-tagged
| Cat.No. : | PRSS8-1994H |
| Product Overview : | Recombinant Human PRSS8 protein(26-325 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 26-325 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | SGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPIL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PRSS8 protease, serine, 8 [ Homo sapiens ] |
| Official Symbol | PRSS8 |
| Synonyms | PRSS8; protease, serine, 8; prostasin; serine protease 8; channel-activating protease 1; CAP1; PROSTASIN; |
| Gene ID | 5652 |
| mRNA Refseq | NM_002773 |
| Protein Refseq | NP_002764 |
| MIM | 600823 |
| UniProt ID | Q16651 |
| ◆ Recombinant Proteins | ||
| RFL25970MF | Recombinant Full Length Mouse Prostasin(Prss8) Protein, His-Tagged | +Inquiry |
| PRSS8-6017H | Recombinant Human PRSS8 Protein (Ala33-Thr272), N-His tagged | +Inquiry |
| RFL30585HF | Recombinant Full Length Human Prostasin(Prss8) Protein, His-Tagged | +Inquiry |
| PRSS8-1994H | Recombinant Human PRSS8 protein, His-tagged | +Inquiry |
| PRSS8-4752R | Recombinant Rat PRSS8 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS8-2865HCL | Recombinant Human PRSS8 cell lysate | +Inquiry |
| PRSS8-441MCL | Recombinant Mouse PRSS8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS8 Products
Required fields are marked with *
My Review for All PRSS8 Products
Required fields are marked with *
