Recombinant Full Length Mouse Protein Reprimo(Rprm) Protein, His-Tagged
Cat.No. : | RFL11572MF |
Product Overview : | Recombinant Full Length Mouse Protein reprimo(Rprm) Protein (Q9JJ72) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-109) |
Form : | Lyophilized powder |
AA Sequence : | MNSVLGNQTDVAGLFLVNSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rprm |
Synonyms | Rprm; Protein reprimo |
UniProt ID | Q9JJ72 |
◆ Recombinant Proteins | ||
RFL21382RF | Recombinant Full Length Rat Protein Reprimo(Rprm) Protein, His-Tagged | +Inquiry |
Rprm-1449R | Recombinant Rat Rprm protein, His-tagged | +Inquiry |
Rprm-1450R | Recombinant Rat Rprm protein, His & MBP-tagged | +Inquiry |
RPRM-2411H | Recombinant Human RPRM, GST-tagged | +Inquiry |
RFL19382BF | Recombinant Full Length Bovine Protein Reprimo(Rprm) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPRM-2176HCL | Recombinant Human RPRM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rprm Products
Required fields are marked with *
My Review for All Rprm Products
Required fields are marked with *
0
Inquiry Basket