Recombinant Full Length Mouse Pyroglutamylated Rfamide Peptide Receptor(Qrfpr) Protein, His-Tagged
Cat.No. : | RFL8297MF |
Product Overview : | Recombinant Full Length Mouse Pyroglutamylated RFamide peptide receptor(Qrfpr) Protein (P83861) (1-433aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-433) |
Form : | Lyophilized powder |
AA Sequence : | MQALNITAEQFSRLLSAHNLTREQFIHRYGLRPLVYTPELPARAKLAFALAGALIFALAL FGNSLVIYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPVTMLQNISDKWLGGAFICKM VPFVQSTAVVTEILTMTCIAVERHQGLIHPFKMKWQYTTRRAFTILGVVWLAAIIVGSPM WHVQRLEIKYDFLYEKEHVCCLEEWASPMHQRIYTTFILVILFLLPLVVMLVLYSKIGYE LWIKKRVGDSSALQTIHGKEMSKIARKKKRAVVMMVTVVALFAACWAPFHVVHMMVEYSN FEKEYDDVTIKMVFAVAQTIGFFNSICNPFVYAFMNENFKKNFLSAVCYCIVRETFSPGQ KPGNSGISMMQKRAKLSRSQRPVAEAKGDLFSDANVDVKLCEQPGEKRQLKRQLAFFSSE LSENSTFGSGHEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Qrfpr |
Synonyms | Qrfpr; Gpr103; Pyroglutamylated RF-amide peptide receptor; AQ27; G-protein coupled receptor 103; Orexigenic neuropeptide QRFP receptor; SP9155 |
UniProt ID | P83861 |
◆ Recombinant Proteins | ||
RFL23796RF | Recombinant Full Length Rat Pyroglutamylated Rfamide Peptide Receptor(Qrfpr) Protein, His-Tagged | +Inquiry |
QRFPR-2093H | Recombinant Human QRFPR, His-tagged | +Inquiry |
QRFPR-4525R | Recombinant Rat QRFPR Protein, His (Fc)-Avi-tagged | +Inquiry |
QRFPR-3837C | Recombinant Chicken QRFPR | +Inquiry |
RFL8297MF | Recombinant Full Length Mouse Pyroglutamylated Rfamide Peptide Receptor(Qrfpr) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Qrfpr Products
Required fields are marked with *
My Review for All Qrfpr Products
Required fields are marked with *
0
Inquiry Basket