Recombinant Full Length Mouse Serine Protease Htra2, Mitochondrial(Htra2) Protein, His-Tagged
Cat.No. : | RFL34599MF |
Product Overview : | Recombinant Full Length Mouse Serine protease HTRA2, mitochondrial(Htra2) Protein (Q9JIY5) (134-458aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (134-458) |
Form : | Lyophilized powder |
AA Sequence : | AVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPISNGSGFVVASDGLI VTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQ GEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNL DGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGTSGSQRRYIGVMMLTLTPSI LIELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEKLAQNAEDVYEAVRT QSQLAVRIRRGSETLTLYVTPEVTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Htra2 |
Synonyms | Htra2; Omi; Prss25; Serine protease HTRA2, mitochondrial; High temperature requirement protein A2; HtrA2; Omi stress-regulated endoprotease; Serine protease 25; Serine proteinase OMI |
UniProt ID | Q9JIY5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Htra2 Products
Required fields are marked with *
My Review for All Htra2 Products
Required fields are marked with *